SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030705 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030705
Domain Number 1 Region: 1049-1097
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 2.16e-17
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 
Domain Number 2 Region: 269-374
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.93e-16
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.001
Further Details:      
 
Domain Number 3 Region: 125-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000628
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 
Domain Number 4 Region: 38-95
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000327
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030705   Gene: ENSCJAG00000016602   Transcript: ENSCJAT00000032448
Sequence length 1401
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:41591116:41738108:1 gene:ENSCJAG00000016602 transcript:ENSCJAT00000032448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CIFKMSGLGENLDPLATDSRKRKLPCDTPGQGLICSGEKRRREQESKYIEELAELISANL
SDIDNFNVKPDKCVILKETVRQIRQIKEQGKTISSDDDVQKADVSSTGQGVIDKDSLGPL
LLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKS
TVNGVSWTNETQRQKSHTFNCRMLMKTHDILEDINTGPEMRQRYETMQCFALSQPRAMME
EGEVDLQSCMICVARRITTGERVYPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDI
IRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPV
TNDRHGFVSTHFLQREQNGYRTNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRA
YGLADPSTTGQMSGARYGGSSNIASVTSGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPN
QQNIMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTS
LLSTLSSPGPKLDNSPNMNITQPSKVSSQDSKSPLGFYCDQNPVESSMCQSNSRDHLGDK
ENKESSVEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSNCKESSVSVTSP
SGVSSSTSGGVSSTSSMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSC
GDGNVVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPS
SSQEKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSVSTNGSHLGTKQQMFQGTNS
LGLKNPQSVQSVRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQE
NYGSSMGGPNRNVTVTQTPSSGDWGLPNSKASRMEPMNSNSMGRPGGDYNTSLPRAALGG
SVPTLPLRSNSIPGVRPMLQPQQQQQQMLQMRPGEIPMGMGANPYGQAASSNQLGSWSDG
MLSMEQVPHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEID
RALGIPELVNQGQALEPKQDAFQGQEAAVMMDQKPGLYGQTYPAQGPPMQGGFHLQGQSP
SFNSMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEL
KMENPTAGGAAVMRPMMQPHVSSHGFLNAQMVAQRSRELLSHHFRQQRVAMMKTQAFSPP
PNVTASPSMDGLLAGPAMPQAPPQQFTYQPNYGMGQQPDPAFGRVSSPPNAMMSSRMGPS
QNPMMQHPQAASMYQSSEMKGWPSGSLARNSSFSQQQFAHQGNPAMYSMVHVNGSSSHMG
PMNMNPMPMSGMPMGPDQKYC
Download sequence
Identical sequences F6YMZ9
ENSCJAP00000030705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]