SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030784 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030784
Domain Number 1 Region: 228-298
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000101
Family RING finger domain, C3HC4 0.036
Further Details:      
 
Domain Number 2 Region: 32-56
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000144
Family CCCH zinc finger 0.0043
Further Details:      
 
Domain Number 3 Region: 164-190
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000863
Family CCCH zinc finger 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000030784
Domain Number - Region: 323-351
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000471
Family CCCH zinc finger 0.0035
Further Details:      
 
Domain Number - Region: 7-27
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00262
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030784   Gene: ENSCJAG00000016733   Transcript: ENSCJAT00000032533
Sequence length 415
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:64525232:64538075:1 gene:ENSCJAG00000016733 transcript:ENSCJAT00000032533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYACACLFRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSA
AAGGAVGTMAHNVPSPTFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAEG
KTNPSMVSNLGSCSDSQPSPEMKPTSYLDAIRSGLDDLEASSSYNNKQQLCPYAAAGECR
FGDACVYLHGEVCEICRLRVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSI
CMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENQIIKSCPECRVISEFVIP
SVYWEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPR
KQLSSQGTVRFFNSVRLWDFIENRESQHVPNNEDVDMTELGDLFMHLSGVESSEP
Download sequence
Identical sequences F6V3K7
ENSCJAP00000030784 ENSCJAP00000030784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]