SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030892 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030892
Domain Number 1 Region: 40-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000471
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030892   Gene: ENSCJAG00000016756   Transcript: ENSCJAT00000032646
Sequence length 718
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:68857841:68929200:1 gene:ENSCJAG00000016756 transcript:ENSCJAT00000032646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKIRRKVTVENTKTISDSTSRRPSVFERLGPSTGSTPETQCRNWLKTGSCLYGNTCRFI
HGPSPRGKGYSSNYRRRSPERPTGDLRERMKNKRQDVDTESQKRNTEESSSPVRKESSRG
RHREKEDIKITKERTPESEEENVEWETNRDDSDNGDINYDYVHELSLEMKRQKIQRELMK
LEQENMEKREEIIIKKEVSPEVVRSKLSPSPSLRKSSKSPKRKSSPKSSSASKKDRKTSA
VPSPLLDQQRNSKSNQSKKKGPRTPSPPPPVPEDIALGKKYKEKYKVKDRIEEKPRDGKD
RGRDFERQREKRDKPRSTSPAGQHHSPISSRHHSSSSQSGSSIQRHSPSPRRKRTPSPSY
QRTLTPPLRRSASPYPSHSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREE
TRGKRDREKDSREEREYEQDQSSSRDHRDDREPRDGRDRRDARDTRERRELRDSRDIRDS
REMRDYSRDAKENRDPRDSRSTRDAHDYRDREGRDTHRKEETYPEESRSYGRNHLREESS
RNEIRNESRNESRSEIRNDRMGRSRGRVPELPEKGSRGSRGSQIDSHSSNSNYHDSWETR
SSYPERDRYPERDNRDQARDSSFERRHGERDRRDNRERASMIFTEQPVDIXPVFSDQRPS
SPIRHQGRNDELERGARERERERARERDKERERQRDWEDKDKGRDDRREKREEIREDR
Download sequence
Identical sequences F6Z514
ENSCJAP00000030892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]