SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030929 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030929
Domain Number 1 Region: 104-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000015
Family EGF-type module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030929   Gene: ENSCJAG00000016803   Transcript: ENSCJAT00000032684
Sequence length 208
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:37238251:37252211:-1 gene:ENSCJAG00000016803 transcript:ENSCJAT00000032684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPPSVVLKLFLAAVLSALVTGDSLERLRRGLAAGTSNPDPPTGSTDQLLPLGGGRDWK
VRDLQEADLDLLRVTLSSKPQALATPSKEEHGKRKKKSKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
Download sequence
Identical sequences F6XDY5
XP_002806639.1.60252 ENSCJAP00000030929 ENSCJAP00000030929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]