SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031079 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031079
Domain Number 1 Region: 3-173
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 8.24e-30
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031079   Gene: ENSCJAG00000016894   Transcript: ENSCJAT00000032843
Sequence length 191
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:9070794:9074302:-1 gene:ENSCJAG00000016894 transcript:ENSCJAT00000032843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQELSKLGLGNDTEVQLQTLELPVDYREAKQRVTGIWEDHQPQLTVHMGMGTSAKVIILE
QSSKNQGYWDADIGFWPEGSVCLPGGPDVLGSGVCMKAVCKCRAVEDVEVIFPLMQAGRF
VCDYTYYLSLHHGKGCVVLINVPPLSRRLPASLLGRALKVTIQEMLEEVGKPRHKAWFKE
NSTMVVQAKGN
Download sequence
Identical sequences F7HWD9
ENSCJAP00000031079 ENSCJAP00000031079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]