SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031125 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000031125
Domain Number - Region: 11-121
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0532
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031125   Gene: ENSCJAG00000033629   Transcript: ENSCJAT00000032892
Sequence length 169
Comment pep:novel chromosome:C_jacchus3.2.1:22:5620455:5626562:1 gene:ENSCJAG00000033629 transcript:ENSCJAT00000032892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPPALQIREANAHLAAVHRRAAELEARLDAAERTVHAQAERLALHDQHLRAALDELDR
AKDREIATLREQLMTSEATVRSLQAAVHRRDELIRQLQQRAELLQDICHHRPPLAGLLAV
LAEAERLGPLPASNPSHAPPGGPGPPVANSTGEEADRDHLQPAVFGTTV
Download sequence
Identical sequences F7IRW7
ENSCJAP00000031125 ENSCJAP00000031125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]