SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031168 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031168
Domain Number 1 Region: 32-391,432-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.83e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031168   Gene: ENSCJAG00000016915   Transcript: ENSCJAT00000032938
Sequence length 585
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:85468869:85504344:-1 gene:ENSCJAG00000016915 transcript:ENSCJAT00000032938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGRGLCKAVAASPFPAWRGAHSEARGGLKSEYDAVVIGAGHNGLVAAAYLQRLGVNT
AVFETRHVIGGAAVTEEIIPEFKFSRASYLLSLLRPQIYTDLELKKHGLRLHLRNPHSFT
PMLEEGAGGKVPRSLLLGTDMAENQKQIAQFSQKDAQAFPRYEEFMHCLALAIDPLLDVA
PVDMAAFQRGSLLQRIRSLSTLKPLLKAGRILGAQLPRYYEVLTAPITKMLDQWFESEPL
KATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGTPGAWGYVQGGMGALSDAIAISATT
HGASIFTEKTVVKVQVNSEGRVQGVVLEDGTEVRSRAVLSSTSPQITFLKLAPQEWLPEE
FVERISQLDTRSPVTKINVAVDRLPSFLAAPNAPGGQPLPHHQCSIHLNCEDTLLLHQAF
EDAMDGLPSHRPMIELCIPSSLDPTLAPAGCHVVSLFTQYTPYTLAGGKAWDEQERNAYA
DRVGTPVFDCIEAYAPGFKDSVVGRDVLTPPDLERIFGLPGGNIFHCAMTLDQLYFARPV
PLHSGYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHVVFGDLKSM
Download sequence
Identical sequences F7IM90
ENSCJAP00000031168 ENSCJAP00000031168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]