SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031633 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031633
Domain Number 1 Region: 18-322
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.45e-80
Family Pancreatic carboxypeptidases 0.000000579
Further Details:      
 
Domain Number 2 Region: 322-386
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000000000275
Family Carboxypeptidase regulatory domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031633   Gene: ENSCJAG00000017197   Transcript: ENSCJAT00000033438
Sequence length 386
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:87291363:87331131:-1 gene:ENSCJAG00000017197 transcript:ENSCJAT00000033438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLLSVFLHLLLLFKLVAPVTFSHHRYDDLVRTLYKVQNECPSITRVYSIGRSVEGRHL
YVLEFSDHPGIHEPLEPEVKYVANMHGNEALGRELMLQLSEFLCEEFRNRNQRIVRLIQD
TRIHILPSMNPDGYEVAAAQGPNKLGYLVGRNNANGVDLNRNFPDLNTYIYYNVEPETRA
VIRWMHSFNFVLSANLHGGAVVANYPYDRSFEHPVRGVRRPANTPTPDDKLFRKLAKIYS
YAHGWMYQGWNCGDYFPDGIINGASWYSLSKGMQDFNYLHTNCFDITLELSCNKFPPQEE
LQREWLGNREALIQFLEEVHQGIKGMVLDENYNNLANAVISVSGINHDCSFTGGDHGDYF
RLLLPGTYTVTAKAPGFDSQTETVTV
Download sequence
Identical sequences F7IEV6
ENSCJAP00000031633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]