SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031949 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031949
Domain Number 1 Region: 389-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.78e-36
Family Calponin-homology domain, CH-domain 0.0000988
Further Details:      
 
Domain Number 2 Region: 86-241,387-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 
Domain Number 3 Region: 784-817
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000609
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000031949
Domain Number - Region: 818-846
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000265
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031949   Gene: ENSCJAG00000017316   Transcript: ENSCJAT00000033768
Sequence length 976
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:183055192:183121101:-1 gene:ENSCJAG00000017316 transcript:ENSCJAT00000033768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKHETMNPAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGTKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLIQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNININFLR
PSQVRHLYDTGETKDIHLEMESLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYAGVSV
TDLTMSWKSGLALCAVIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLPSSDTLDLNAEEKAVLIASTRSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEAPRGHRGERPSLVSTLTDRRMDAALGNQN
KVKYMATQLLAKFEENAPAQSIGIRRQLTQERGASQPSCCLPGQGRPVPTPQWKQGSMKK
EFPQNLGGSDTCYFCQKRVYVMERLSAEGKFFHRSCFKCEYCATTLRLSAYAYDIEDGKF
YCKPHYCYRLSGYAQRKRPAVAPLSGQEARGPLKDGPTTDATGRANAVAGSTERSAGSGV
NGLEEPSIAKRLRGTPERIELENYRLSLKQAEALQEVPEETQAEHNLSSVLDTGAEEDVA
SRSAHRAAGCPLATWP
Download sequence
Identical sequences F7HVS7
ENSCJAP00000031949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]