SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031981 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031981
Domain Number 1 Region: 402-684
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.42e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000932
Further Details:      
 
Domain Number 2 Region: 251-399
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.02e-38
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00094
Further Details:      
 
Domain Number 3 Region: 686-793
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.17e-26
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031981   Gene: ENSCJAG00000017350   Transcript: ENSCJAT00000033802
Sequence length 803
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:6209211:6269180:1 gene:ENSCJAG00000017350 transcript:ENSCJAT00000033802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEALAAEAVASRLERQEEDIRWLWAEVQRLRDEQLSAPDRGQAEGPCVTREVAQLRAE
NRDLRHRLCRLRLCLAEELSRQATPEIVRTERFAAPGTVQPPSSQSREKDMKKKKMKESE
PDHEVKQQPSFIKERLNLFEILKKDHQLLLAIYGKKGDRSNVITVRVADGQTVEGEVWKT
TPYQVAAEIRLEPGENVFLGTAIKFLWLLQRPFKKQTASTIEILRFSLKMMARIVFLTHP
IILLNALPTCFHVFQGKPLPNGFLKSSLVMKIAVSSTELSALENICKVIIKEKQPFERLE
VSKEILLEMFKYNKFKCRILNEKVSTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKN
SSTYWEGNPEMETLQRIYGISFPDNKMMRNWEKFQEEAKNRDHRKIGKEQELFFFHDLSP
GSCFFLPRGAFIYNTLVDFIREEYHKRDFTEVLSPNMFNSKLWEASGHWQHYSENMFTFE
IEKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQ
DDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQ
NSLMEFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSKDG
DDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSE
FFEEGFMADIDLDHSCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTRDNRIHGEIL
VTSAIDKLKNLKKSRALSAEEDF
Download sequence
Identical sequences F7IRD8
ENSCJAP00000031981 ENSCJAP00000031981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]