SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032181 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032181
Domain Number 1 Region: 572-862
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.33e-84
Family Protein kinases, catalytic subunit 0.0000000000528
Further Details:      
 
Domain Number 2 Region: 120-210
Classification Level Classification E-value
Superfamily Immunoglobulin 9.39e-25
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 29-127
Classification Level Classification E-value
Superfamily Immunoglobulin 3.08e-19
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 205-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000285
Family I set domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000032181
Domain Number - Region: 322-409
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00249
Family Frizzled cysteine-rich domain 0.0097
Further Details:      
 
Domain Number - Region: 512-569
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0994
Family Neurotransmitter-gated ion-channel transmembrane pore 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032181   Gene: ENSCJAG00000017434   Transcript: ENSCJAT00000034019
Sequence length 875
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:154137555:154262683:1 gene:ENSCJAG00000017434 transcript:ENSCJAT00000034019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRELVNIPLVHILTLVAFSRTEKLPKAPVITTPLETVDALVEEVATFMCAVESYPQPEIS
WTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMK
PKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSPLRENSRIAVLESGSLRIHNV
QKEDAGQYRCVAKNSLGTAYSKVVKLEVEVFARILRAPESHNVTFGSFVTLHCTATGIPV
PTITWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTSKAAAT
ISIAEMLFISSFSKPQKDNKGYCAQYRGEVCNAVLAKDTLVFLNTSYADPEEAQELLVHA
AWNELKVVSPLCRPAAEALLCNHIFQECSPGVVPTPTPICREYCLAVKELFCAKEWLAME
EKTHRGLYRSEMHLLSVPECSKLPSMHWDPMACARLPHLDYNKENLNTFPPMTSSKPSVD
IPNLPSSSSSSFSVSPTYSMTVIISIMSSFAIFVLLTITTLYCCRRRKQWKNKKRESATV
TLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARA
PGLLPHEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLL
FEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPLLSCAEQLCIARQVAAGMA
YLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESI
FYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPMELYNL
MRLCWSKLPTDRPSFASIHRILERMCERAEGTVSV
Download sequence
Identical sequences F7FYI7
ENSCJAP00000032181 ENSCJAP00000032174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]