SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032267 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032267
Domain Number 1 Region: 31-139
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000111
Further Details:      
 
Domain Number 2 Region: 205-301
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.7e-33
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 3 Region: 383-493
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.97e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032267   Gene: ENSCJAG00000017508   Transcript: ENSCJAT00000034108
Sequence length 505
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:122451925:122518149:1 gene:ENSCJAG00000017508 transcript:ENSCJAT00000034108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVQQQPPPPGRVTNVGLLLTPQENESLFTFGKKCGTMSSAVVQLYAADRNCMWSKKCS
GVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFA
NEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGSQVNNI
SHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGIS
EAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPPPP
PARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPP
PSVLGVGPVAPPPPPPPPPPPGPPPLAGLGLSSDGDHQVPTTAGNKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences F7DKT5
ENSCJAP00000032267 ENSCJAP00000032267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]