SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032299 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032299
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000162
Further Details:      
 
Domain Number 2 Region: 167-263
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.28e-34
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 3 Region: 345-406
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000471
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032299   Gene: ENSCJAG00000017508   Transcript: ENSCJAT00000034140
Sequence length 406
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:122451925:122515996:1 gene:ENSCJAG00000017508 transcript:ENSCJAT00000034140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFV
YNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRNLKRRDPPNGPNLPMA
TVDIKNPEITTNRFYGSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPN
TGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPP
PPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPN
RMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPLAGLGLSSDGDHQ
VPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQG
Download sequence
Identical sequences F7D2M3
ENSCJAP00000032299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]