SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032442 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032442
Domain Number 1 Region: 50-313,412-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.77e-80
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000337
Further Details:      
 
Domain Number 2 Region: 290-408
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.39e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000604
Further Details:      
 
Domain Number 3 Region: 503-664
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.83e-32
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032442   Gene: ENSCJAG00000017583   Transcript: ENSCJAT00000034289
Sequence length 664
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:204147572:204176265:-1 gene:ENSCJAG00000017583 transcript:ENSCJAT00000034289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVRRLSRLLSAQRLALAKAWPAVSPTGTRGFHFTVDGNKRASAKVSESISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTQDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCEKIX
XXXXXXXXXXXXXXXXXXXXXXVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCTSVPPA
IRSY
Download sequence
Identical sequences F7DJM6
ENSCJAP00000032430 ENSCJAP00000032442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]