SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032485 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032485
Domain Number 1 Region: 119-181
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000432
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 34-76
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000628
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032485   Gene: ENSCJAG00000017613   Transcript: ENSCJAT00000034333
Sequence length 708
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:203981423:204126996:-1 gene:ENSCJAG00000017613 transcript:ENSCJAT00000034333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPPGECTYAGRKRRRPLQKRRPALGVEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAVQEQGSRQPVAGTPSPEDSHPPAGSAVLEGRLLLESLN
GFALVVSAEGKIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFRRQLHWAMDPPQV
VSGQPPPSETGDDAVLGRLLRAQEWGAGVPIEYSAFLTRCFVCRVRCLLNSTSGFLTMQF
QGKLKFLFGQKKKAPSGAVLPPRLSLFCVVAPVLLPSATEMKMRSALLRAKPRADSAAPT
DAKVKATMSLCKSEQHGKPNYSAGRSSRESGILVLREQTDTGQWAQVPARAPCLCLRGSP
DLVLKPKRTSRDREEQQQRVLSRASGASGRRETPGPTKPLPWMAGRRSEDGARPKVQPNQ
SGLLSLRPTSHGSCLPYPCVQGTFNASSSGTFRNLPISQPPSPPPSAHAIRTSRASWDVC
EDQVHPPLCHFPQGSLQHPQPETQHLASRGYTTEDGKLRGVQMPPRGLCSPTLLLDVPIK
MEKDSGSEDAAHGCMPSQVWGLGAGDRSRLVTFPTRMPLKTEPDSLHQVYTAHLGHGVLG
AQPQGRATMGRSRELATFHPAHCARLEPTHSLPQLEPPHQLCARGRGELSSLPSCTCRAA
ETAPVVKREPLDSPPWATYSQGRAPGMFPKSALATLVPPQASECTFLP
Download sequence
Identical sequences F7HBY6
ENSCJAP00000032469 ENSCJAP00000032485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]