SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032497 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032497
Domain Number 1 Region: 1-333
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.79e-97
Family Phosphofructokinase 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032497   Gene: ENSCJAG00000017630   Transcript: ENSCJAT00000034346
Sequence length 367
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:21:48149132:48157495:1 gene:ENSCJAG00000017630 transcript:ENSCJAT00000034346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAVRSAVRTGISQGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLP
KGHLESIVENIRTYGIHALLAVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVP
GTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVFVVETMGGYCGYLATVTGIAVGADAAY
VFEDPFNIHDLKANVEHMTEKMKTDIQRGLVLRNEKCHDHYTTEFLYNLYSSEGKGVFDC
RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWVSEKLREVYRKGRVFANAPDSACVIGLK
KKAVAFSPVTELKKDTDFEHRMPREQWWLSLRLMLKMLAHYRISMAAYVSGELEHVTRRT
LSMETGF
Download sequence
Identical sequences F7HBT1
ENSCJAP00000032497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]