SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032693 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032693
Domain Number 1 Region: 144-265
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-32
Family Spectrin repeat 0.000000541
Further Details:      
 
Domain Number 2 Region: 25-140
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-24
Family Spectrin repeat 0.000000481
Further Details:      
 
Domain Number 3 Region: 269-380
Classification Level Classification E-value
Superfamily Spectrin repeat 6.19e-23
Family Spectrin repeat 0.000000565
Further Details:      
 
Domain Number 4 Region: 373-501
Classification Level Classification E-value
Superfamily EF-hand 1.74e-22
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000032693
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00446
Family Spectrin repeat 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032693   Gene: ENSCJAG00000017702   Transcript: ENSCJAT00000034553
Sequence length 528
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:43611972:43693870:-1 gene:ENSCJAG00000017702 transcript:ENSCJAT00000034553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQ
KDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKI
CDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVH
SIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYSIRISSSNPYSTVTMDE
IRNKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQ
ITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWEL
LLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMG
YDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYIL
AEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYTAFSSALYGESDL
Download sequence
Identical sequences F7HBQ7
ENSCJAP00000032693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]