SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032957 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032957
Domain Number 1 Region: 29-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-42
Family Galectin (animal S-lectin) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032957   Gene: ENSCJAG00000017839   Transcript: ENSCJAT00000034829
Sequence length 162
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:43833344:43857602:-1 gene:ENSCJAG00000017839 transcript:ENSCJAT00000034829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNGDGKRSPMTRLSKEKSLLRLDYVLKSLPFTARLNTPMGPGRTVVVKGEVNTNAKSFN
VDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNTTSFPFSPGMYFEMIIYCDV
KEFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Download sequence
Identical sequences F7GQ98
ENSCJAP00000032957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]