SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033196 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033196
Domain Number 1 Region: 23-92
Classification Level Classification E-value
Superfamily Lipocalins 4.17e-17
Family Retinol binding protein-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033196   Gene: ENSCJAG00000017975   Transcript: ENSCJAT00000035082
Sequence length 166
Comment pep:novel chromosome:C_jacchus3.2.1:1:177320253:177323680:-1 gene:ENSCJAG00000017975 transcript:ENSCJAT00000035082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLLGVTLGLAAALSFTVKEEDITGTWYVKAVVTDKDLPEEKRPRKVSPVTVTALDHG
DLEATFTFMRNDRCFQKKILMRKTEEPGKFSTCLSTVEMDQITPSLWEALAIDTLRKTRV
GSRTLRVRWGQEAHIPAGAAREGTLRLLLQRPAPWGSVPHGRAHGS
Download sequence
Identical sequences F6RZ79
ENSCJAP00000033196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]