SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033222 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033222
Domain Number 1 Region: 83-266
Classification Level Classification E-value
Superfamily RNI-like 5.89e-34
Family Cyclin A/CDK2-associated p19, Skp2 0.01
Further Details:      
 
Domain Number 2 Region: 18-56
Classification Level Classification E-value
Superfamily F-box domain 0.00000563
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033222   Gene: ENSCJAG00000017990   Transcript: ENSCJAT00000035108
Sequence length 300
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:89801736:89804784:1 gene:ENSCJAG00000017990 transcript:ENSCJAT00000035108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEPPMEPSGGEQEPGAVRLLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRALVQLHLA
GLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVA
LAGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLK
DEAIVYLAQRRGAGLRSLSLAVNANVGDTAVQELARNCPELQHLDLTGCLRVGSDGVRTL
AEYCPALRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV
Download sequence
Identical sequences F6RBZ2
ENSCJAP00000033217 ENSCJAP00000033217 ENSCJAP00000033222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]