SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033455 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033455
Domain Number 1 Region: 1955-2231
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.37e-64
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000236
Further Details:      
 
Domain Number 2 Region: 30-262
Classification Level Classification E-value
Superfamily Thiolase-like 1.03e-61
Family Thiolase-related 0.0041
Further Details:      
 
Domain Number 3 Region: 519-644,707-804
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 9.94e-41
Family FabD-like 0.0059
Further Details:      
 
Domain Number 4 Region: 235-432
Classification Level Classification E-value
Superfamily Thiolase-like 9.12e-37
Family Thiolase-related 0.0019
Further Details:      
 
Domain Number 5 Region: 1582-1701
Classification Level Classification E-value
Superfamily GroES-like 3.14e-16
Family Alcohol dehydrogenase-like, N-terminal domain 0.0052
Further Details:      
 
Domain Number 6 Region: 1667-1724
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000000111
Family Alcohol dehydrogenase-like, C-terminal domain 0.0035
Further Details:      
 
Domain Number 7 Region: 1238-1429
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000697
Family UbiE/COQ5-like 0.026
Further Details:      
 
Domain Number 8 Region: 1856-1920
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000124
Family Acyl-carrier protein (ACP) 0.00011
Further Details:      
 
Domain Number 9 Region: 644-700
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000432
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0074
Further Details:      
 
Domain Number 10 Region: 1733-1802
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000558
Family Tyrosine-dependent oxidoreductases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033455   Gene: ENSCJAG00000018059   Transcript: ENSCJAT00000035346
Sequence length 2241
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:131245998:131265764:-1 gene:ENSCJAG00000018059 transcript:ENSCJAT00000035346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQRPGLPLRCAPASLSAARTAARALTRATMEEVVIAGMSGKLPESENLQEFWDNLIGGVD
MVTDDDRRWKAGGSMGRPRRSGKKDLSRFDASFFGVHPKQAHTMDPQLRLLLEVTYEAIV
DGGINPASLRGTHTGVWVGVSGSEASEALSRDPETLLGYSMVGCQRAMMANRLSFFFDFR
GPSIALDTACSSSLLALHNAYEAIRSGVCPAAIVGGINVLLKPNTSVQFMRLGMLSPEGA
CKAFDEAGNGYCRSEAVVVFLMTLIPGPTGVGTIFNAGTDTDGLIHKGVSLPSGDVPKQY
IHFLIMKSTSSPQSRRSVPPSPTPDKVGDPQELGIVQALCATRQEPLLIGSTKSNMGHPE
PASGLAALAKVLLSLEHGLWAPNLHFHNPNPEIPALLDGRLQVVEQPLPVRGGNVGINSF
GFGGSNVHVILKPNTQPPPAPAPHATLPHLLRASGRTAEAVQELLEQGLQHSQDLAFLSM
LNNIAAAPATAMPFRGYAVLGGESGGPEVQQVPTGERPVWFICSGMGTQWRGMGLNLMRL
SLFRDSILRSDEAVKPLGLKVSQLLLSTDESTFDDIVHAFVSLTAIQIGLIDLLSCMGLR
PDGIIGHSLGEVACGYADGCLSQEEAVLSAYWRGQCIKEANIPKGAMAAVGLSWEECKQR
CPPGVVPACHNSEDTVTISGPQGPVHEFVEQLKQEGVFAKEVRTGGMAFHSYFMEGIAPP
LLRALKKVIREPKPRSARWLSTSIPEAQWHTSLAHTCSPEYNVNNLVSPVLFQEALGHVP
EHAVVLEIAPHALLQAVLKRGLKPSCTIIPLMKKDHRDNLELFLTGIGKLHLSGIDANPN
ALFPPVEFPVPRGTPLISPLIKWDHSLAWDVPAAEDFPNGSGSPSASVYTIDASPESPDH
YLVDHRIDGRVIFPATGYLCLVWKTLARALGLAVEQLPVVFEDVVVHQATILPKTGTMSL
EVRLLEASHTFEVSESGHLIVSGKVYQWEDPDPRLFDHPESPTPSPGEPFFLAQAEVYKD
LRLCGYDYGPHFQGILEASLDGNSGKLLWKDNWVPFLDAMLQMSILSKSQRSLLLPTRIT
AIHIDPATHRQKLYTQQDKAQVADVVVSRCLKTTVAGGVHVFLLHASAAPRRQQEQQAPI
LEKFCFTPHVEDGCLSGNTALKEELRLCKGLVQALQTKVTQQGLKMAVPGLDGAQVPQDL
PQQALPQLLSAACGLQLNGNLQLELAQLLAQERSELPEDPLLSGLLDSPALKACVDTALE
NMPSLKMKVVEVLAGHGHLYSRIPGLLNTQPLLQLSYTATDRHPQALEAAHAKLQQHDIA
QGQWDPSDPAPSALGSTDLLVCNCAVAALGDPASAVGNMVAALREGGFLLLHTLLQGHPL
GETVAFLTSAEPQYAQGILSQDAWESLFAKMSLRLVGLKKSFYGSVLFLCRRPAPQDSPI
FLPVEDTSFRWVDSLKGILADSSSRPVWLKAINCTTSGVVGLVNCLRQEPGGHRIRCLLL
SNLSSTSRVPDVDPGSAELQKVLQGDLVMNVYRDGAWGAFRHFPLEQDKPEELTAHAYVM
VLTRGDLSSIRWVCSSLRLAQPASPGGAQLCTVYYASLNFRDIMLATGKLSPDAIPGKWA
TKDCLLGMEFSGRDASGKRVMGLVPAEGLATSVLLSPDFLWDVPSHWTLEEAASVPVVYT
TAYYALVVRGRVQRGETVLIHSSGGVGQAAIAIALSLGCRVFTSQLVGSDTCDHRVTREA
CPELDYFVVFSSVSCGRGNAGQTNYGFANSTMERICEKRRHDGLPGLAVQWGAIGDVGIV
LEAMGTNDTVIGGTLPQRMASCLEVLDLFLNQPHAVLSSFVLAEKAASYKDGDGRRDLVK
AVAHILGIRDLAGVNLDSSLADLGLDSLMGVEVRQTLEREHDLALSMREVRQLTLRKLQE
LSSKAGAASKLASPTPKNSPAHLQSQLNLRSLLVNPEGPTLTRLNSVQSSERPLFLVHPI
EGSTVVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYG
ACVAFEMCSQLQAQQSPAPTNNSLFLFDGSHTYVLAYTQSYRAKLTPGCEAEAETEAMCF
FVQQFTDAEHSRVLEMLLPLKGLEERVAAAVDLITKSHQALDRQELSFAALSFYYKLRAA
EQYTPKAKYHGNVTLLRAKTSGAYGEDLGADYNLSQVCDGKVSVHIIEGDHRTLLEGRGL
ESIISIIHSSLAEPRVSVREG
Download sequence
Identical sequences F6R004
ENSCJAP00000033647 ENSCJAP00000033455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]