SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033672 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033672
Domain Number 1 Region: 91-335
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.68e-64
Family G proteins 0.0000000843
Further Details:      
 
Domain Number 2 Region: 413-516
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.37e-32
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 317-407
Classification Level Classification E-value
Superfamily Translation proteins 9.15e-22
Family Elongation factors 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033672   Gene: ENSCJAG00000018191   Transcript: ENSCJAT00000035572
Sequence length 520
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:45926929:45946762:1 gene:ENSCJAG00000018191 transcript:ENSCJAT00000035572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APVESSQEEQSLCEGSNSAVSMELSEPVVENGETEMSPEESWEHKEEISEAEPGSGSLGD
GRPPEESTHEMMEEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTG
MVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDA
PGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLI
NKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWY
IGLPFIPYLDNLPNFSRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKH
NVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVI
IEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRT
AGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
Download sequence
Identical sequences F6QCY0
ENSCJAP00000033672 ENSCJAP00000033672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]