SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033792 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033792
Domain Number 1 Region: 43-108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000005
Family Complement control module/SCR domain 0.00032
Further Details:      
 
Domain Number 2 Region: 99-134
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000526
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033792   Gene: ENSCJAG00000003840   Transcript: ENSCJAT00000035700
Sequence length 134
Comment pep:novel chromosome:C_jacchus3.2.1:19:29518210:29649115:1 gene:ENSCJAG00000003840 transcript:ENSCJAT00000035700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVASSPRSPEPMEPPAPRLPFCCGGTPLAVVVLLALPVAWGQCNAPEQLPFSRPINLTDE
SQFPIGTYLMYKCRPGYYGRSFSIVCLKNSVWTSAKDECRRKSCRNPSEPVNGMVHVIKD
IKFGSQINYSCNKG
Download sequence
Identical sequences F6SGB1
ENSCJAP00000033792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]