SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034232 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034232
Domain Number 1 Region: 97-155
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.000000000772
Family Troponin T 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034232   Gene: ENSCJAG00000018439   Transcript: ENSCJAT00000036163
Sequence length 155
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:128536965:128672629:-1 gene:ENSCJAG00000018439 transcript:ENSCJAT00000036163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRPLVPPLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEELIALKER
IEKRRAERAEQQRIRAEKERERQNRLAEEKARREEEDAKRRAEDDLKKKKALSSMGANYS
SYLAKADQKRGKKQTAREMKKKILAERRKPLNIDH
Download sequence
Identical sequences F7C995
ENSCJAP00000034232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]