SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034404 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034404
Domain Number 1 Region: 10-78,168-431
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.05e-58
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 
Domain Number 2 Region: 532-653
Classification Level Classification E-value
Superfamily PKD domain 4.84e-20
Family PKD domain 0.00016
Further Details:      
 
Domain Number 3 Region: 665-735
Classification Level Classification E-value
Superfamily PKD domain 0.0000458
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034404   Gene: ENSCJAG00000018526   Transcript: ENSCJAT00000036337
Sequence length 930
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:94092592:94306155:-1 gene:ENSCJAG00000018526 transcript:ENSCJAT00000036337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIMLLTDPEIESSLLISSDEGATYQKYRLNFYIQSLLFHPKQEDWILAYSQDQKLYSSAE
FGRRWQLIQEGVVPNRFYWSVMGSNKEPDLVHLEARTVDGHSHYLTCRMQNCTEANRNKP
FPGYIDPDSLIVQDDYVFVQPFLYSSGKLHHYERGKLNAVFFNHPLPLYQLLKDMHVIST
DENQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNVMIDLYEVAGIKGM
FLANKKIDNQVKTFITYNKGRDWRLLQAPDTDLRGDPVHCLLPYCSLHLHLKVSENPYTS
GIIASKDTAPSIIVASGNIGSELSDTDISMFVSSDAGNTWRQIFEEEHSVLYLDQGGVLV
AMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEW
QLVKVDYKSIFDRRCAEEDYRPWQLHSQGEACIMGAKRIYKKRKSERKCMQGKYAGAMES
KPCVCTEADFDCDYGYERHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSTGYRKVVSNNCT
DGVREQYTAKPQKCPGKAPRGLRIVTADGKLTAEQGHNVTLMVQLEEGDVQRTLIQVDFG
DGIAVSYVNLSSMEDGIKHVYQNVGIFRVTVQVDNSLGSDSAVLYLHVTCPLEHVHLSLP
FVTTKNKEVNATAVLWPSQVGTLTYVWWYGNNTEPLITLEGSISFRFTSEGMNTITVQVS
AGNAILQDTKTIAVYEEFRSLRLSFSPNLDDYNPDIPEWRRDIGRVIKKSLVEATGVPGQ
HILVAVLPGLPTTAELFVLPYQDPAGENKRSADDLEQISELLIHKLNQNSVHFELKPGVQ
VLVHAAHLTAAPLVDLTPTHSGSAMLMLLSVVFVGLAVFVIYKFKRRVALPSPPSPSTQP
GDSSLRLQRARHATPPSTPKRGSAGAQFAI
Download sequence
Identical sequences F7HU45
ENSCJAP00000034404 ENSCJAP00000034404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]