SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034448 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034448
Domain Number 1 Region: 111-370
Classification Level Classification E-value
Superfamily L domain-like 6.24e-48
Family Ngr ectodomain-like 0.0063
Further Details:      
 
Domain Number 2 Region: 386-689
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.19e-41
Family Rhodopsin-like 0.00076
Further Details:      
 
Domain Number 3 Region: 39-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034448   Gene: ENSCJAG00000018522   Transcript: ENSCJAT00000036382
Sequence length 729
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:144815300:144881540:1 gene:ENSCJAG00000018522 transcript:ENSCJAT00000036382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIILGFKHLFSLRLIAMFLLLHFIVLINVKDFALSEGSMITPPCQKGYFPCGNLTKCLPR
AFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANKVALTQECFLKHYPQCCDCKETE
LECVNGGLKSVPVISNNVTLLSLKKNKIHSLPDKVFIKYTKLKKIFLQYNCIKHISRKAF
FGLYNLQILYLNHNCITMLRPGIFKDLHQLTWLILDDNPITRISQRLFMGLNSLFFLSMV
NNYLEALPKQMCAQMPQLNWVDLEGNRIKYLTNSTFLSCDSLTVLDLSSNMIMELSPHLF
KDLKLLQKLNLSSNPLMYLHKNQFESLKQLQSLDLERIEIPNINTRMFQPMKNLSHIYFK
NFRYCSYAPHVRICMPLTDGISSFEDLLANDILRIFVWVIAFIICFGNLFVIGMRSFIKA
ENTTHAMSIKILCCADCLMGVYLFFVGFFDIKYRGQYQKYALLWMESMQCRLMGFLAMLS
TEVSVLLLTYLTLEKFLAIVFPFSNIRPGKRQTSVILICIWMAGFLIAVIPFWNEDYFGN
FYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLLAFLIIVFSYITMFCSIQKTALQTTE
VRNHIGRDMAVANRFLFIVFSDAICWIPVFVIKILSLFRVEMPDTMTSWIVIFFLPVNSA
LNPILYTLTTSFFKDKLKELLHRHRSKSIFKIKKKSLSTSIVWIDDSSSLKLGVLNKITL
GDSIMKPVS
Download sequence
Identical sequences F7IQ25
ENSCJAP00000034448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]