SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034449 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034449
Domain Number 1 Region: 111-393
Classification Level Classification E-value
Superfamily L domain-like 1.19e-48
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 410-714
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.1e-41
Family Rhodopsin-like 0.00076
Further Details:      
 
Domain Number 3 Region: 39-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034449   Gene: ENSCJAG00000018522   Transcript: ENSCJAT00000036383
Sequence length 753
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:144815300:144881540:1 gene:ENSCJAG00000018522 transcript:ENSCJAT00000036383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIILGFKHLFSLRLIAMFLLLHFIVLINVKDFALSEGSMITPPCQKGYFPCGNLTKCLPR
AFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANKVALTQECFLKHYPQCCDCKETE
LECVNGGLKSVPVISNNVTLLSLKKNKIHSLPDKVFIKYTKLKKIFLQYNCIKHISRKAF
FGLYNLQILYLNHNCITMLRPGIFKDLHQLTWLILDDNPITRISQRLFMGLNSLFFLSMV
NNYLEALPKQMCAQMPQLNWVDLEGNRIKYLTNSTFLSCDSLTVLFLPRNQIDFVPEKTF
SSLKNLGELDLSSNMIMELSPHLFKDLKLLQKLNLSSNPLMYLHKNQFESLKQLQSLDLE
RIEIPNINTRMFQPMKNLSHIYFKNFRYCSYAPHVRICMPLTDGISSFEDLLANDILRIF
VWVIAFIICFGNLFVIGMRSFIKAENTTHAMSIKILCCADCLMGVYLFFVGFFDIKYRGQ
YQKYALLWMESMQCRLMGFLAMLSTEVSVLLLTYLTLEKFLAIVFPFSNIRPGKRQTSVI
LICIWMAGFLIAVIPFWNEDYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLLA
FLIIVFSYITMFCSIQKTALQTTEVRNHIGRDMAVANRFLFIVFSDAICWIPVFVIKILS
LFRVEMPDTMTSWIVIFFLPVNSALNPILYTLTTSFFKDKLKELLHRHRSKSIFKIKKKS
LSTSIVWIDDSSSLKLGVLNKITLGDSIMKPVS
Download sequence
Identical sequences F7IQ24
ENSCJAP00000034424 ENSCJAP00000034449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]