SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034494 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034494
Domain Number 1 Region: 46-101
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000304
Family Homeodomain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034494   Gene: ENSCJAG00000018583   Transcript: ENSCJAT00000036430
Sequence length 282
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:81645525:81649230:-1 gene:ENSCJAG00000018583 transcript:ENSCJAT00000036430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPVVPSRPRPSPLTSRACFNPKKCDFLQIR
YGEPQIFERTEVMAPIQRAHSKVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAR
EVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTY
TQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLS
TQGYGASLGFNSTTDCLYKDQTASWKLNFHADCLDYKDQTSS
Download sequence
Identical sequences F7IK95
ENSCJAP00000034494 ENSCJAP00000034494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]