SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034744 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034744
Domain Number 1 Region: 322-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.09e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000113
Further Details:      
 
Domain Number 2 Region: 145-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.71e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000902
Further Details:      
 
Domain Number 3 Region: 606-714
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.7e-28
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 83-143
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000262
Family TGS domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034744   Gene: ENSCJAG00000018663   Transcript: ENSCJAT00000036692
Sequence length 723
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:169825980:169852385:-1 gene:ENSCJAG00000018663 transcript:ENSCJAT00000036692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEEQASSPSGKMGSEEKPIGADEEKRKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEM
YNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIA
KVNNVVWDLDRPLEEDCTLALLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIDFI
RSEYRKRGFQEVVTPNIYNSRLWMTSGHWQHYSENMFSFEVEKEQFALKPMNCPGHCLMF
DHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRMVYSVFGFSFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWELNSGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPSCDEYAQKVRQQFHAAKFMADVDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTVSETVERLQQLKESRSKQAE
EEF
Download sequence
Identical sequences F7I8C3
ENSCJAP00000034710 XP_002745122.1.60252 ENSCJAP00000034740 ENSCJAP00000034744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]