SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034896 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034896
Domain Number 1 Region: 153-294
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.91e-27
Family UBX domain 0.01
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily UBA-like 7.98e-17
Family UBA domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034896   Gene: ENSCJAG00000018751   Transcript: ENSCJAT00000036849
Sequence length 297
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:118355627:118358265:-1 gene:ENSCJAG00000018751 transcript:ENSCJAT00000036849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGPGSAAGEGKPILSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPPAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEEPGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS
Download sequence
Identical sequences A0A2K5PRG5 F7IK28
XP_009006592.1.60252 XP_017359440.1.71028 ENSCJAP00000034896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]