SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035177 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035177
Domain Number 1 Region: 416-537
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.49e-36
Family Frizzled cysteine-rich domain 0.00015
Further Details:      
 
Domain Number 2 Region: 137-249
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.29e-31
Family Frizzled cysteine-rich domain 0.00065
Further Details:      
 
Domain Number 3 Region: 305-343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 269-306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 342-377
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035177   Gene: ENSCJAG00000018936   Transcript: ENSCJAT00000037143
Sequence length 542
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:142915292:143114409:1 gene:ENSCJAG00000018936 transcript:ENSCJAT00000037143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSPALAPEERYRTAGSPKPVLGADDNNMGDGCSQKLATSNLLRFLLLILIPCICAVVL
LLVILLSYVGTLQKAYFKSNGSEPLVTDGEVQRSDIILINTVYNQSTLVSTAHPEQHIPA
WTTDVSLPKDQSHRNTSACMNITHSQCQMLPYHATLTPLLSVVRNMEVEKFLKFFTYLHR
LSCYQHIMLFGCSLAFPECITDGDDSHGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLKC
SQFRNETESSNVSRICFSLQQENGKQLLCGGGESFLCASGICIPRKLQCNGYNDCDDWSD
EAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCACHSQGLVECRNGQCIPSTF
QCDGDEDCKDGSDEANCSGSQTPCQEGDQRCLYNPCLDSCGGSSLCDPNNSQNNCSQCEP
ISLELCMNLPYNHTSYPNYLGHRTQKEASVSWESSLFPALVQTNCYKYLMFFACTILVPK
CDVNTGERIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYV
EG
Download sequence
Identical sequences F7HP97
ENSCJAP00000035177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]