SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035188 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035188
Domain Number 1 Region: 719-967
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.36e-77
Family Eukaryotic proteases 0.0000768
Further Details:      
 
Domain Number 2 Region: 386-507
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.15e-36
Family Frizzled cysteine-rich domain 0.00015
Further Details:      
 
Domain Number 3 Region: 71-182
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.05e-31
Family Frizzled cysteine-rich domain 0.00065
Further Details:      
 
Domain Number 4 Region: 587-628
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 511-549
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 202-239
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 316-357
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 277-313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000956
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 237-275
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000995
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 553-585
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 11 Region: 622-723
Classification Level Classification E-value
Superfamily SRCR-like 0.0000178
Family Scavenger receptor cysteine-rich (SRCR) domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035188   Gene: ENSCJAG00000018936   Transcript: ENSCJAT00000037154
Sequence length 975
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:142915279:143177816:1 gene:ENSCJAG00000018936 transcript:ENSCJAT00000037154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSPALAPEERYRTAGSPKPVLGADDNNMGDGCSQKLATSNLLRFLLLILIPCICAVVL
LLVILLSYVGACMNITHSQCQMLPYHATLTPLLSVVRNMEVEKFLKFFTYLHRLSCYQHI
MLFGCSLAFPECITDGDDSHGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLKCSQFRNET
ESSNVSRICFSLQQENGKQLLCGGGESFLCASGICIPRKLQCNGYNDCDDWSDEAHCNCS
ENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCSATSEHRCGDGRCITMEWVCDGDHD
CVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEANCSGSQTPCQEGDQR
CLYNPCLDSCGGSSLCDPNNSQNNCSQCEPISLELCMNLPYNHTSYPNYLGHRTQKEASV
SWESSLFPALVQTNCYKYLMFFACTILVPKCDVNTGERIPPCRALCEHSKERCESVLGIV
GLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCHSGRCVLASRRCDGQADCDD
DSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDNMDEKNCSFCQDDELECANHAC
VSRHLWCDGEADCSDSSDEWDCVTLSKNVNSSSFLMVHRAATEHHVCADGWQETLSQLAC
KQMGLGETPVTELIQEQEKDQQWLTLHSNWETLNGTTLHELLVNGQPCQSRSKISLLCTK
QDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEG
RENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDINETGY
VRPVCLPSLEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEQCQSYFDMKTITTR
MICAGYESGTVDSCMGDSGGPLVCEHPGGQWTLFGLTSWGSVCFSKVLGPGVYSNVSYFI
EWIKRQIYIQTFLLK
Download sequence
Identical sequences F7HP60
ENSCJAP00000035188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]