SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035391 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000035391
Domain Number - Region: 216-266
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0353
Family Frizzled cysteine-rich domain 0.012
Further Details:      
 
Domain Number - Region: 25-42
Classification Level Classification E-value
Superfamily Granulin repeat 0.0458
Family Granulin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035391   Gene: ENSCJAG00000019058   Transcript: ENSCJAT00000037374
Sequence length 529
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:156824859:156981023:1 gene:ENSCJAG00000019058 transcript:ENSCJAT00000037374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRGSRLLRRLDTPRRGLVWKGAAENVCEHLRICPQGYTCCTSEMEENLANRSRTELETSL
RDSSRALQAMLATQLRSFDDHFQHLLNDSERALQDAFPGAFGELYAQNARAFRDLYSELR
LYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPREL
RLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCP
DYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGASGVESVIGGVHMWLAEAINSLQ
DNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDV
QDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKP
DMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGSGDGCPDDLCGRKNSRKSSS
SRTPLTHALPGLSEQEGQKTSAASCPQPPSFLLPLLLALALTVARPRWR
Download sequence
Identical sequences F7HWX6
ENSCJAP00000035391 ENSCJAP00000035391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]