SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035543 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035543
Domain Number 1 Region: 320-683
Classification Level Classification E-value
Superfamily SIS domain 4.36e-97
Family double-SIS domain 0.00000075
Further Details:      
 
Domain Number 2 Region: 3-214,251-295
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.72e-50
Family Class II glutamine amidotransferases 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035543   Gene: ENSCJAG00000019141   Transcript: ENSCJAT00000037540
Sequence length 683
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:37538516:37595562:1 gene:ENSCJAG00000019141 transcript:ENSCJAT00000037540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGVDGGNDKDWEANACKIQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDISFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTRDRGGSPLLNGVRSEHQLFTDHITILYRTGKDKKGSCNL
SRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTA
GDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKD
HIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCF
FLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAY
TSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQK
SVLIMGRGYHYATCLEGALQNKKIHMIYLRGNLTSRLKHGPLALVDKLMPVIMIIMRDHT
YAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAF
HLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences F7I1M0
ENSCJAP00000035543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]