SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035544 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035544
Domain Number 1 Region: 323-686
Classification Level Classification E-value
Superfamily SIS domain 4.45e-97
Family double-SIS domain 0.00000075
Further Details:      
 
Domain Number 2 Region: 3-214,254-298
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.26e-50
Family Class II glutamine amidotransferases 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035544   Gene: ENSCJAG00000019141   Transcript: ENSCJAT00000037541
Sequence length 686
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:37538516:37595562:1 gene:ENSCJAG00000019141 transcript:ENSCJAT00000037541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGVDGGNDKDWEANACKIQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDISFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTRDRGGSPLLNGVRSEHQLFTDHITILYRTGCSSKDKKGS
CNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIK
RTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGG
LKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDD
VCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVAST
KAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELY
HQKSVLIMGRGYHYATCLEGALQNKKIHMIYLRGNLTSRLKHGPLALVDKLMPVIMIIMR
DHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQL
LAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences F7I1L9
ENSCJAP00000035544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]