SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035765 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035765
Domain Number 1 Region: 57-123
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035765   Gene: ENSCJAG00000019266   Transcript: ENSCJAT00000037770
Sequence length 211
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:36964517:36988763:-1 gene:ENSCJAG00000019266 transcript:ENSCJAT00000037770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRRA
HLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLK
RQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERG
SMQSLGSDEGYSSASIKRIKLQDSHKACLGL
Download sequence
Identical sequences A0A1D5Q709 A0A2I3GHG2 A0A2I3LQ07 A0A2J8XBV4 A0A2K5DB55 A0A2K5P4F5 A0A2K5RVZ4 A0A2K5VDB1 A0A2K5YJE6 A0A2K6T499 F7EGA0
XP_003262559.1.23891 XP_011840411.1.47321 ENSCJAP00000035765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]