SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035903 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035903
Domain Number 1 Region: 92-166
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.06e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035903   Gene: ENSCJAG00000019339   Transcript: ENSCJAT00000037915
Sequence length 242
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:70550268:70552072:1 gene:ENSCJAG00000019339 transcript:ENSCJAT00000037915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMDLFETGSYFFYLDGENVTLQPLEAAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEE
HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT
VANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDAFSYRPKQENLEGADFL
RTCSSQWPSVSDHSRGLVITAKEGGASTDSSASSSLRCLSSIVDSISSEERKLPCVEEVV
EK
Download sequence
Identical sequences F7FZG8
XP_002752845.1.60252 ENSCJAP00000035903 ENSCJAP00000035903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]