SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035908 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035908
Domain Number 1 Region: 83-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035908   Gene: ENSCJAG00000019340   Transcript: ENSCJAT00000037920
Sequence length 255
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:70559605:70562341:1 gene:ENSCJAG00000019340 transcript:ENSCJAT00000037920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDMMDGCQFSPSEYFYDGSCIPSPEGEFGEEFEPRVAAFGVHKAELQGSDEDEHVRAPTG
HHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK
VEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSS
TFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDPASLSPVASTDSQP
ATPGNSSSRLIYHVL
Download sequence
Identical sequences F7FZD8
ENSCJAP00000035908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]