SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035985 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035985
Domain Number 1 Region: 92-153
Classification Level Classification E-value
Superfamily Homeodomain-like 1.04e-21
Family Homeodomain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035985   Gene: ENSCJAG00000031540   Transcript: ENSCJAT00000038000
Sequence length 284
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:35894506:35926718:-1 gene:ENSCJAG00000031540 transcript:ENSCJAT00000038000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGGAERDRGPARRAESGGSGGRGGEEDMRADGGGRSPTEVAGTSASSPTGSRESGADS
DGQPGPGEADHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRC
QYVVGRERTELARQLNLSETQVKVWFQNRRTKEDQSRDLEKRASSSASEAFATSNILRLL
EQGRLLSVPRAPSLLALTPGLPGLPASHRGTSLGDPRNSSPRLNPLPSASASPPLPPPLP
AVCFSSAPLLDLPAGYELGSSAFEPYSWLERKVGSTGSGKKANT
Download sequence
Identical sequences F7E1V7
ENSCJAP00000035985 ENSCJAP00000035985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]