SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036131 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000036131
Domain Number - Region: 255-324
Classification Level Classification E-value
Superfamily Globin-like 0.000155
Family Globins 0.011
Further Details:      
 
Domain Number - Region: 89-129
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00053
Family Calpain large subunit, catalytic domain (domain II) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036131   Gene: ENSCJAG00000019454   Transcript: ENSCJAT00000038156
Sequence length 775
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:147316716:147518537:1 gene:ENSCJAG00000019454 transcript:ENSCJAT00000038156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLIKKGITPGSGLPSVSETDETANSQTDLSQITKATSQGNTASQVILGKGTDEQMDFG
LGDTHQSDGLNLERDVVSQTTATQEKSQEELTTNNRVSKEIWLDFEDFCICFQNIYIFHK
PSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVRWGEYGALTKDSPPIEPG
LLTAETFSWKSLKPLNLVLKIHTYATKATMVRLPVGRHMLLFNAYSPVGHSIHICSMVPL
VIGDEHVVLPNFEPESCRFTEQSLLIMKAIGNVIANFKDKSKLSAALKDLQTAHYPVPFH
DKELTAQHFRVFHLSLWRLMKKVQITKPPPNFKFAFRAMVLDLDLLDSSLEEVSLVEWLD
IKYCMPTSDQEYSPEEVAAAIKIQAMWRGTYVRLLLKARIPVLDTKENISVADTLQKVWA
ILEMNLEQYALSLLRLMFKSKCKSMESYPCYQDEETKIAFADYTVTYQEQPPNSWFIVFR
ETFLVPQDMILVPKVYTTLPICILHVVNNDTMEQVPKVFQKVVPYLYTKNKKGYTFVAEA
FTGDTFVPGSRWKLRLIGSYAPLPCLSRDPPCSAFAIKEIRDYYIPNDKNILFRYSVKVV
TPQPATIQVRTSKLDTFIKLQVLENEETMVSSTGKGQAIIPVFNFLKSEKGLSSQFHGEK
HEELITLGSPDSHTISEGQKSSVTSKITRKGKEKSSEKEKAAKEKQAPRFDPQQISSTVH
TQQEDPNKPYWILRLLRLVCITLAGSLRKHLMLRVRLYLQAKLNGQKKQKCLQVV
Download sequence
Identical sequences F7HJH9
ENSCJAP00000036131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]