SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036300 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036300
Domain Number 1 Region: 2740-2857,2889-3012
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.45e-24
Family Extended AAA-ATPase domain 0.081
Further Details:      
 
Domain Number 2 Region: 1832-1973
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.96e-18
Family Extended AAA-ATPase domain 0.022
Further Details:      
 
Domain Number 3 Region: 2367-2670
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.3e-17
Family G proteins 0.074
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036300
Domain Number - Region: 1097-1190
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0225
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number - Region: 475-526
Classification Level Classification E-value
Superfamily YugE-like 0.0667
Family YugE-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036300   Gene: ENSCJAG00000019525   Transcript: ENSCJAT00000038336
Sequence length 3289
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:127736337:127865015:-1 gene:ENSCJAG00000019525 transcript:ENSCJAT00000038336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMAPDVRLEYLEEVASIVLKFKPDKWSKLIGAEENMALFTEFFEKPDVLVLVLTLNVAG
MVIPCLGFPESLKSKGVYFIKKKPENITKDNYKAQLLYGDISPTPVDQLIVVVEEVLYSL
LNQSENMDGWPQVVSEDIVKQVHRLKNEMYVMSGKIKGKTLLPIPEHLGILDGTLESVER
IPSSLDNSLLHAIETIIIDWSHQIRDVLSKDSAQALLDGLHPLPRVEFEFWDTQLMNLKC
IHEQLNRPKVNKIVEILEKAKSCYWPALQNVYTSVTEGLKEASDIVLYLKPLRILLEEME
QADFTVLPTFIAKVLDTICLIWATSEYYNTPVRIIVILQEFCNQIIEMTRTFLSPEEVLK
GLQGEIVEVLSGISLSVNVLKEFYQMYDFCCMNMKLFFKDKKPEPWEFPSSLAFSRMNSF
FHRVQTIEELYKTAIEFLKLEKIELGGVRGNLLGNLVTQIYDEVFELVKVFANCKYDPLD
PGDSSFDHDYANFEIKIQDLDRRLATIFCQAFDDCCSIESSAKVSVRWGLGVEKTVQMRW
LFLHVSVMLELFDAELDNAKILYDAQMAASEEGNIPPIHKNMPPVAGQLKWSLELQERLE
VSMKHLKYIEHPVMSGVEAKLIYEKYDEMMELLRRHREKVYQQWVVGVDQDCHFNLGQPL
ILRDAASNLIHVNFSKALVAVLREVKYLNFQQQKEIPDSAESLFSENETFRKFVGNLELV
VGWYNEIKTTGKAVEYLLIKSELEAIDVKLSRAETTLFWNGEGVFQYIQEMREILHNLQS
RMQKAKQNIEGISQAMQDCSANPLFERKDNKKEALLDLDGRIANLNKRYTAVRDAGVKIQ
AMVAENAELFRADTSSLPWKDYVNYIDDMVLAEFEQFIRTSLNFLMDNMVIDVSIAPLFE
IRMELDEDGLAFNPSLEVGSERGLLALIEGLVNDIYNVASWMNCFKMHVRVYCYQTDLED
ITDLIEMREDVSSLVVNAMKQAEEYQDSFERYSYLWTDDLQEFMKNFLIYGCVPSAEDLD
TRTDDTIPKTPPTLAQFQEQIDSYEKLYEEVSKCENTKVFHGWLQCDCRPFKQALLSIIR
RWSFMFKRHLSDHVTNSLADLEAFMKGARMGLTKPLKEGDYDGLVEVMGHLMKVKERQAA
TDNMFEPLKQTIELLKTYGEEMPEELHLKLQELPEHWTNTKKLAIQVKQHVAPLQANEVS
ILRRKCQQFELKQHEFREKFRHQAPFSFSNPNPYKSLNKQQKSISAMEGIMEALSKSGSL
FEVTIPDYKQLKACHREVRLLKELWDMIVMVNTSIEDWKTTKWKDINVEQMDIDCKKFAK
DVRSLDKEMKTWDAFVGLDNTVKNMITSLRAVSELQNPAIRERHWQQLMQATQVKFKMSE
ETTLADLLQLNLHNYEDEVRNIVDKAVKESGMEKQKVLKALDSTWSTMEFEHEPHPRTGT
MMLKSNEVLVETLEDNQVQLQNLMMSKYLAHFLREVTSWQQKLSTADSVISIWFEVQRTW
SHLESIFIGSEDIRAQLPEDSKRFDDIDQEFKALMEDAVKTPNVVEATNKPGLYDKLEAL
KKSLAICEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKL
KFQLDANHEPLKVGLGMYSKEDEYVDFDQECDLSGQVEVWLNRVLDRMCSTLRHEIPEAV
VTYEEKPREQWILDYPAQVALTCTQIWWTTEVGLAFARLEEGYENAIKDYNKKQISQLNV
LITLLIGNLNAGDRMKIMTICTIDVHARDVVAKMIMAKLDVESSQAFTWQSQLRHRWDEE
KRHCFANICDAQIQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKT
ETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAV
QVKCVQDAIRAKKKTFDFLGETIGLIPTVGIFITMNPGYAGRAELPENLKALFRYRGPDR
REWLCSHSSVPVARSGQRRGAEGELGREEVIKSSQPPQPPREGKAASVPYPASSVSPQII
RQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQPRVPAVFKTTSNSSHM
REAHGKLHLKRQRLLELFFGFSLHMYSMYHEEESHVNVFQASQSQGKQLSAGGRHAEPSF
YLGGASVSPSPYILAAGRVQGEGLVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRA
GILYINPADLGWNPVVSSWIERRKVQSEKANLIILFDKYLPTCLDKLRFGFKKITPVPEI
TVIQMILYLLECLLTEKSVPPDSPKELYELYFVFACFWAFGGAMFQDQLVDHRVEFSKWW
INEFKTIKFPSQGTIFDYYIDPDTKKFLPWTDKVPSFELDPDVPLQASLVHTTETIRIRY
FMDLLMEKSWPVMLVGNAGTGKSVLMGDKLDSLNTDYYLVQAVPFNFYTTSAMLQGVLEK
PLEKKSGRNYGPPGTKKLIYFIDDMNMPEVDKYGTVAPHTLIRQHIDHRHWWFRYDRHKL
TLKDVHNCQYVCMNPTAGSFTIDPQASEQRHFCVFAVSFPGQEALTTIYSTILTQHLAFR
SVSMATQRISSQLVAAALALHQKIAATFLPTAIKFHYVFNLRDLSNIFQGLLFSMAEVLK
TPLDFVCLWLHEAERVYGDKMVDEKDQEILRRVSMVARDHSSTWLWVQDLGEELLFAKPN
IFCHFAQGIGDPKYVPVTDVAHLNKLLVDVLDSYNEVNAIMNLVLFEDAMAHVCRINRIL
ESPRGNALLVGVGGSGKQSLSRLAAYISGLDVFQITLKKGYGISDLKVDLAAQYIKAAVK
NVPSVFLMTDSQVAEEQFLVLINDLLASGEIPGLFAEDEVENIISSMRPQVKSLGITDTR
EECWKFFIEKVRRQLKVILCFSPVGSVLRVRARKFPAVVNCTAIDWFHEWPEDALVSVSA
RFLEETEGIPREVKASLSFFMSYVHTTVNDMSKVYLATERRYNYTTPKTFLEQIKLYQNL
LAKKRTELAAKVERLENGLMKLQSTASQVDDLKAKLAIQEAELKQKNESADKLIQVVGIE
TEKVSKEKAIADEEEVKVEVINKEVTQRFESCELSSDLLGPESALATAAXDVNNKGPSSE
LFPVPSPQSATLAASSLVRLIPVIRWFQSPGAQLGKLGNAPTALPEQDGVTTPAFCCSLA
RPYQGNPTFDPEFIRSKSTAAAGLCSWCINIVRFYEVYCDVAPKRQALEEANAELAEAQE
KLSRIKNKIAELNANLSNLTSAFEKATAEKIKCQQEADATNRVISLANR
Download sequence
Identical sequences F7HDS7
ENSCJAP00000036300 ENSCJAP00000036300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]