SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036325 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036325
Domain Number 1 Region: 1810-1951
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-18
Family Extended AAA-ATPase domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036325
Domain Number - Region: 2347-2493
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000647
Family G proteins 0.062
Further Details:      
 
Domain Number - Region: 1092-1185
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0163
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number - Region: 475-523
Classification Level Classification E-value
Superfamily YugE-like 0.0929
Family YugE-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036325   Gene: ENSCJAG00000019525   Transcript: ENSCJAT00000038362
Sequence length 2498
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:127765088:127865015:-1 gene:ENSCJAG00000019525 transcript:ENSCJAT00000038362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMAPDVRLEYLEEVASIVLKFKPDKWSKLIGAEENMALFTEFFEKPDVLVLVLTLNVAG
MVIPCLGFPESLKSKGVYFIKKKPENITKDNYKAQLLYGDISPTPVDQLIVVVEEVLYSL
LNQSENMDGWPQVVSEDIVKQVHRLKNEMYVMSGKIKGKTLLPIPEHLGILDGTLESVER
IPSSLDNSLLHAIETIIIDWSHQIRDVLSKDSAQALLDGLHPLPRVEFEFWDTQLMNLKC
IHEQLNRPKVNKIVEILEKAKSCYWPALQNVYTSVTEGLKEASDIVLYLKPLRILLEEME
QADFTVLPTFIAKVLDTICLIWATSEYYNTPVRIIVILQEFCNQIIEMTRTFLSPEEVLK
GLQGEIVEVLSGISLSVNVLKEFYQMYDFCCMNMKLFFKDKKPEPWEFPSSLAFSRMNSF
FHRVQTIEELYKTAIEFLKLEKIELGGVRGNLLGNLVTQIYDEVFELVKVFANCKYDPLD
PGDSSFDHDYANFEIKIQDLDRRLATIFCQAFDDCCSIESSAKLLYMCGLLERLILTEMV
LRSVMLELFDAELDNAKILYDAQMAASEEGNIPPIHKNMPPVAGQLKWSLELQERLEVSM
KHLKYIEHPVMSGVEAKLIYEKYDEMMELLRRHREKVYQQWVVGVDQDCHFNLGQPLILR
DAASNLIHVNFSKALVAVLREVKYLNFQQQKEIPDSAESLFSENETFRKFVGNLELVVGW
YNEIKTTGKAVEYLLIKSELEAIDVKLSRAETTLFWNGEGVFQYIQEMREILHNLQSRMQ
KAKQNIEGISQAMQDCSANPLFERKDNKKEALLDLDGRIANLNKRYTAVRDAGVKIQAMV
AENAELFRADTSSLPWKDYVNYIDDMVLAEFEQFIRTSLNFLMDNMVIDDSIAPLFEIRM
ELDEDGLAFNPSLEVGSERGLLALIEGLVNDIYNVARFIPRLAKGKMSYKTDLEDITDLI
EMREDVSSLVVNAMKQAEEYQDSFERYSYLWTDDLQEFMKNFLIYGCVPSAEDLDTRTDD
TIPKTPPTLAQFQEQIDSYEKLYEEVSKCENTKVFHGWLQCDCRPFKQALLSIIRRWSFM
FKRHLSDHVTNSLADLEAFMKGARMGLTKPLKEGDYDGLVEVMGHLMKVKERQAATDNMF
EPLKQTIELLKTYGEEMPEELHLKLQELPEHWTNTKKLAIQVKQHVAPLQANEVSILRRK
CQQFELKQHEFREKFRHQAPFSFSNPNPYKSLNKSISAMEGIMEALSKSGSLFEVTIPDY
KQLKACHREVRLLKELWDMIVMVNTSIEDWKTTKWKDINVEQMDIDCKKFAKDVRSLDKE
MKTWDAFVGLDNTVKNMITSLRAVSELQNPAIRERHWQQLMQATQVKFKMSEETTLADLL
QLNLHNYEDEVRNIVDKAVKESGMEKVLKALDSTWSTMEFEHEPHPRTGTMMLKSNEVLV
ETLEDNQVQLQNLMMSKYLAHFLREVTSWQQKLSTADSVISIWFEVQRTWSHLESIFIGS
EDIRAQLPEDSKRFDDIDQEFKALMEDAVKTPNVVEATNKPGLYDKLEALKKSLAICEKA
LAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFQLDANHEP
LKVGLGMYSKEDEYVDFDQECDLSGQVEVWLNRVLDRMCSTLRHEIPEAVVTYEEKPREQ
WILDYPAQIWWTTEVGLAFARLEEGYENAIKDYNKKQISQLNVLITLLIGNLNAGDRMKI
MTICTIDVHARDLWLILQVESSQAFTWQSQLRHRWDEEKRHCFANICDAQIQYSYEYLGN
TPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQ
MDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKTFDFLGET
IGLIPTVGIFITMNPGYAGRAELPENLKALFRYRGPDKGVAVVSQASHSSVPVARSGQRR
GAEGELGREEVIKSSQDGRVWWLMPVIHFRWPRKPPQPPREGKAASVPYPASSVSPQIIR
QSIVELKLQAEDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQVHHPQGPRGDPAQVSPP
SLPPTPETPTQCIPGAPGPESWAREEGRPVMAMTRAGSQGQQGWPEPLLLAQRFAPSDPP
ALGHRQDARVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPV
VSSWIERRKVQSEKANLIILFDKYLPTCLDKLRFGFKKITPVPEITVIQMILYLLECLLT
EKSVPPDSPKELYELYFVFACFWAFGGAMFQDQLVDHRVEFSKWWINEFKTIKFPSQGTI
FDYYIDPDTKKFLPWTDKVPSFELDPDVPLQASLVHTTETIRIRYFMDLLMEKSWPVMLV
GNAGTGKSVLMGDKLDSLNTDYYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGT
KKLIYFIDDMNMPEVDKYGTVAPHTLIRQHIDHRHWLD
Download sequence
Identical sequences F7H3C0
ENSCJAP00000036325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]