SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036534 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036534
Domain Number 1 Region: 33-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 605-745
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-28
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 4 Region: 1014-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 5.88e-28
Family Spectrin repeat 0.00000226
Further Details:      
 
Domain Number 5 Region: 1855-2009
Classification Level Classification E-value
Superfamily Spectrin repeat 3.21e-27
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 6 Region: 907-1054
Classification Level Classification E-value
Superfamily Spectrin repeat 4.85e-27
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 7 Region: 1536-1676
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-23
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 1232-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-22
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 9 Region: 1694-1801
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-22
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 10 Region: 429-529
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-21
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 11 Region: 742-858
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-20
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 12 Region: 534-640
Classification Level Classification E-value
Superfamily Spectrin repeat 3.89e-18
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 13 Region: 2198-2269
Classification Level Classification E-value
Superfamily PH domain-like 7.74e-18
Family Pleckstrin-homology domain (PH domain) 0.00014
Further Details:      
 
Domain Number 14 Region: 2015-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1390-1486
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000209
Family Spectrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036534
Domain Number - Region: 1174-1252
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0691
Family Spectrin repeat 0.00000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036534   Gene: ENSCJAG00000019629   Transcript: ENSCJAT00000038590
Sequence length 2271
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:89688404:89826014:-1 gene:ENSCJAG00000019629 transcript:ENSCJAT00000038590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPADMTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQ
KKTFTKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENV
DKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAK
DALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEH
AFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDH
AIETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKF
QEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIR
QEKLEQLARRFDRKAAMRETWLNENQHLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEE
RVRALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLRSRRQRLETTLVLQKLFQD
MLHSINWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTE
GNGYQPCDPQVIHDRISHLEQCFGELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEK
EQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLDHIFQEAHGMVVRKQFGHPQIEA
RMKEVSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEG
ATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTNRLQVLRELYQQVLAQ
ADLRRQRLQEALDLYTVFGETDACELWMGEKEKWLAQMEMPDTLEDLEVVQHRFDILDQE
MKTLMTQIDGVNLAANSLVESGHPRSGEVKRYQDHLNARWQAFQTLVLKRREAVDSALRV
HNYCVDCEETSKWITDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQARVDALER
ESQQLMDSHPEQKEDIGQRQKHLEELWQGLQQALQGQEASLGEASQLQAFLQDLDDFGAW
LSIAQKAVASEDMPESLPEAEQLLQQHAAIKDEIDGHQESYQRVKESGEKVIRGQTDPEY
LLLGQRLEGLDTGWDALDRMWESRSRTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEP
PDSLEAAEAGIRKFEDFLVSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRH
RKNDEKAQEATVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQ
AFVAELASYEGWLENIDAEGKQLMEEKPQFAALVSERLKALHLLWDELQATTKEKTQRLS
AARSSDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELG
ELFAQVPSMGEEAGDTDLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEE
RLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRIEDVLQRGQQLVEAAEIDCQDLE
ERLGHLQSSWDRLREAAVGRLQRLRDANEAQQYYLDAGEAEAWIGEQELYVISDETPKDE
EGAIVMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLK
DMAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFA
RETGAIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAAS
YDLHRYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQ
DVATRLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLL
SWMESIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQA
SEEIREKLQQVVSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGD
FGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQMAERPTEETGPQEEEG
ETAGEAPVSHQAATERTSPGEEEGTWPQDLQQPPPLGQHEDRQKSAGDERPAQSPLGLFL
AYMESPSGKGKFTAFLPEKRSLNVESETGLHKMTLQPALYESWNNLYCVLRNSELTFYKD
AKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGR
Download sequence
Identical sequences F7GD65
ENSCJAP00000036534 ENSCJAP00000036534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]