SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036565 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036565
Domain Number 1 Region: 502-717
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-103
Family Thrombospondin C-terminal domain 0.000000141
Further Details:      
 
Domain Number 2 Region: 375-500
Classification Level Classification E-value
Superfamily TSP type-3 repeat 9.68e-35
Family TSP type-3 repeat 0.00000525
Further Details:      
 
Domain Number 3 Region: 306-377
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000157
Family TSP type-3 repeat 0.00024
Further Details:      
 
Domain Number 4 Region: 1-36
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.000000000000262
Family Assembly domain of cartilage oligomeric matrix protein 0.0012
Further Details:      
 
Domain Number 5 Region: 231-318
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000196
Family TSP type-3 repeat 0.00018
Further Details:      
 
Domain Number 6 Region: 146-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000382
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 64-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000122
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036565
Domain Number - Region: 196-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00839
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036565   Gene: ENSCJAG00000019641   Transcript: ENSCJAT00000038621
Sequence length 735
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:128138105:128185430:-1 gene:ENSCJAG00000019641 transcript:ENSCJAT00000038621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLRFQSPTPSTVVPPAPPAPPTRP
PRRCDSNPCFRGVQCTDSREGFQCGPCPEGYTGNGITCIDIDECKYYPCYLGVRCVNLSP
GFRCDACPVGFTGPMVQGVGISFAKSNKQVCTDIDECRNGVCVPNSICINTLGSYRCGPC
KPGYTGDQTRGCKTERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYVCGKDVD
IDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLI
HNVDQRNSDKDIFGDACDNCVSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPRFP
NRDQRDEDGDGVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTI
INSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICESD
FDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSD
PGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPF
RAVAEPGIQLKVLVAGTGPGEHVRNSLRHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQ
HRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPE
DFQEFQTQNFDRLDN
Download sequence
Identical sequences F7FMT4
ENSCJAP00000036565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]