SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036574 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036574
Domain Number 1 Region: 432-645
Classification Level Classification E-value
Superfamily TPR-like 3.79e-32
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 660-801
Classification Level Classification E-value
Superfamily TPR-like 7.11e-22
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036574
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily SIS domain 0.0304
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036574   Gene: ENSCJAG00000019685   Transcript: ENSCJAT00000038630
Sequence length 916
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:80133611:80183489:-1 gene:ENSCJAG00000019685 transcript:ENSCJAT00000038630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADINLKEITLIVGVVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSS
VIASLLFAVHPVHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNSIVWTPVALTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLVKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSEL
CCDWTMGTIPLIESLLDIRNLATFTFFCVLGALGVFSLRYSGDSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISTKSVFKKLSWICLSMVILTHSLK
TFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFVQATHVQPDDI
GAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLW
YNLAIVYIELKEPNEALKNFNHALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLSY
INEEPLDANGYFNLGMLAMDDKKDTEAEIWMKKAIKLQADFRSALFNLALLYSQTAKELK
ALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFEKILEMDPSNVQGKHNLCVV
YFEEKDLLKAERCLVETLALAPHEEYIQRHLNIVRDKISSSGFVEQPIFPISKTSGVEGG
DRIPAESVNEIRGESRQTQIIKTSDNKSLSKSNKQLGKNRDKEPPHKTAKDIKEIEKKRV
AALKRLEEIERILNGE
Download sequence
Identical sequences F7F981
ENSCJAP00000036574 ENSCJAP00000036574 XP_002752880.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]