SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036625 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036625
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily PH domain-like 6.71e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000991
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036625
Domain Number - Region: 184-284
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00719
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036625   Gene: ENSCJAG00000019706   Transcript: ENSCJAT00000038683
Sequence length 322
Comment pep:novel chromosome:C_jacchus3.2.1:22:17884911:17893026:-1 gene:ENSCJAG00000019706 transcript:ENSCJAT00000038683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYLYDATRNVYRIISIGGAKAIINST
VTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQVPPSPLVSANGPGEEKLFRSQS
ADAPGPTERERLKKMLSEGSVGEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEA
QRAEAERLRQRVAELEAQAASEVTPASEKEGPGQGQSLEQLEALVQTKDQEIQTLKSQTG
GPREAPEAAEREETQQKVQDLETRNTELEHQLRAMERSLEEARAERERARAEVGRAAQLL
DVRLFELSELREGLARLAEAAP
Download sequence
Identical sequences F6U966
ENSCJAP00000036625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]