SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036655 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036655
Domain Number 1 Region: 65-368,535-571
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.42e-42
Family FAD-linked reductases, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036655   Gene: ENSCJAG00000019726   Transcript: ENSCJAT00000038713
Sequence length 610
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:21223596:21237088:1 gene:ENSCJAG00000019726 transcript:ENSCJAT00000038713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLLVLLLAVLLLAGLCKVYLGLFPGSSPNPFFEDVKRPPAPLVTDKEARTKVLRQAFS
TSQVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGCXXXXXXXXXXLPTGI
HYIGRMEEGSIGRFILDQITEGQLDWAPLSSPFDIIVLEGPSGPKEYPMYSGAKAYIQGL
KEKFPQEEAIIDKYIKLVKVVSRGVPHAILLKFLPLPVVQLLDRCGLLTRFSPFLHASTQ
SLAEVLQQLGASSELQAVLSYIFPTYGVTPSHTAFSMHALVVDHYLKGGFYPRGGSSEIA
FHTIPVIQRAGGAVLTKATVQGILLDSAGKACGVSVKKGHELVNIYCPIVVSNAGLFNTY
EHLLPENARCLPGVKQQLGLVRPSLSMISIFLCLRGTKEDLGLPSTNYYVYYDTDIDQAT
ERYISMPREEAAQHIPFLFISSPSAKDPTWENRFPDRSTMIVLIPSAYEWFEEWQAELKG
KRGSDYETFKSSFVEASMSTVMKLFPQLEGKVDNVTAGSPLTNRFYLAAPRGACYGADHD
LGRLHPRVMASLRAQSPIPNLYLTGQDIFICGLLGALQGALLCSSAILKRNLYSDLKDLG
SRIREQKKKN
Download sequence
Identical sequences F6TLA0
ENSCJAP00000036657 ENSCJAP00000036655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]