SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036676 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036676
Domain Number 1 Region: 520-603
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 1.44e-36
Family Kix domain of CBP (creb binding protein) 0.00000371
Further Details:      
 
Domain Number 2 Region: 1009-1134
Classification Level Classification E-value
Superfamily Bromodomain 9.42e-36
Family Bromodomain 0.000000486
Further Details:      
 
Domain Number 3 Region: 1997-2050
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 3.18e-25
Family Nuclear receptor coactivator interlocking domain 0.0000839
Further Details:      
 
Domain Number 4 Region: 313-374
Classification Level Classification E-value
Superfamily TAZ domain 0.0000000000000124
Family TAZ domain 0.0000231
Further Details:      
 
Domain Number 5 Region: 1636-1683
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000388
Family ZZ domain 0.0000902
Further Details:      
 
Domain Number 6 Region: 1700-1786
Classification Level Classification E-value
Superfamily TAZ domain 0.0000000301
Family TAZ domain 0.0000306
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036676
Domain Number - Region: 1215-1256
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00384
Family PHD domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036676   Gene: ENSCJAG00000019712   Transcript: ENSCJAT00000038735
Sequence length 2339
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:3755674:3888493:-1 gene:ENSCJAG00000019712 transcript:ENSCJAT00000038735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFGSLFDLENDLPDELIPNGGELGLLTSGNLVPDAASKHKQLSELLRGGSSSSINPGIGN
VSASSPVQQGLGGQAQGQPNSANMSSLGAMGKSPLSQGDSSAPSLPKQAASTSGPTPPAS
QALNPQAQKLATSSPTTSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQASQGQAQVMNG
SLGAAGRGRGAGMPYPTPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGGMAKMGITG
NTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTT
VGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNV
LNHMTHCQAGKACQAILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQRAYAALG
LPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMTIPAGGITTDQQPPNLISES
ALPTSLGAANPLMNDGSNSGSIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLV
QAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKR
RSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPTTIDGPLPLPVNRMQVSQGMNSFNP
MSLGNVQLPQAPMGPRTASPMNHSVQINSMGSVPGMAISPSRMPQPPNMMGAHTNNMMAQ
APAQSQFLPQNQFPSSSGAMSVNSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQASQL
PCPPVTQSPLHPTPPPASTAAGMPSLQHPTPPGMTPPQPAAPTQPSTPVSSSGQTPTPTP
GSVPSATQTQSTPTVQTAAQSQVTPQPQTPAQPPSVATPQSSQQQPTPVHAQPPGTPLSQ
AAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKVEAHTENTEPDPGESKGEPRSEMME
EDLQGASQVKEETDTAEQKSEPMEVDEKKPEVKVEVKEEEESSTNGTASQSTSPSQPRKK
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLD
TGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRK
YEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTIS
KDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENK
FSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSG
EMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPR
CLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWY
KKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEER
KKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYA
TMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDMDGRDAFLTLARDKHWEFSSLRRS
KWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVK
WGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCRDEAGGAAH
QGCKRRPMGAARCVAAHRLCCYHASTARKQMPKNKCPVPFCLNIKHKLRQQQIQHRLQQA
QLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAGFP
SVARTQPPTTVSAGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNGMP
PGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGMPRPVMSM
QAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIK
QRTAKYVATGIHQQPSLQNLNAMQAGVPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPNM
ASMNPQYREMLRKGNAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMPQHLPLQGSSIGQ
MAAQMGQLSQMGQPGMGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSG
QPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSP
HPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
Download sequence
Identical sequences F6T0U2
ENSCJAP00000036676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]