SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036680 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036680
Domain Number 1 Region: 861-916
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 2.31e-26
Family Nuclear receptor coactivator interlocking domain 0.0000545
Further Details:      
 
Domain Number 2 Region: 507-554
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000188
Family ZZ domain 0.0000902
Further Details:      
 
Domain Number 3 Region: 573-654
Classification Level Classification E-value
Superfamily TAZ domain 0.0000000000301
Family TAZ domain 0.0000169
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036680
Domain Number - Region: 86-127
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00064
Family PHD domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036680   Gene: ENSCJAG00000019712   Transcript: ENSCJAT00000038739
Sequence length 1251
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:3755674:3888493:-1 gene:ENSCJAG00000019712 transcript:ENSCJAT00000038739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLG
DDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
KKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVK
PGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYIS
YLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQK
IPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEES
IKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPN
VSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDMDGRDAFLTLARD
KHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCY
NTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLP
SCRMKRVVQHTKAVSQTNGGCPVSPSPSAANHAKHCQNKCPVPFCLNIKHKLRQQQIQHR
LQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSP
AGFPSVARTQPPTTVSAGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNIN
NGMPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGMPRP
VMSMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMA
AFIKQRTAKYVANQPGLQPQPGLQPQPGMQPQPGMQPQPGIHQQPSLQNLNAMQAGVPRP
GVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQ
QQQQQGNAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMPQHLPLQGSSIGQMAAQMGQL
SQMGQPGMGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLP
GQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTM
ASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
Download sequence
Identical sequences F6T0B6
ENSCJAP00000036680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]