SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036765 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036765
Domain Number 1 Region: 275-549
Classification Level Classification E-value
Superfamily Folate-binding domain 1.15e-77
Family Aminomethyltransferase folate-binding domain 0.0000415
Further Details:      
 
Domain Number 2 Region: 64-174
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.06e-30
Family L-aminoacid/polyamine oxidase 0.0072
Further Details:      
 
Domain Number 3 Region: 43-64,175-239
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000272
Family FAD-linked reductases, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036765   Gene: ENSCJAG00000019768   Transcript: ENSCJAT00000038828
Sequence length 573
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:129194265:129251340:1 gene:ENSCJAG00000019768 transcript:ENSCJAT00000038828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VERQSRNSDNWRWLCWCESGLSPGQSGDERCGPAGEIRAHGWIYLACRFWAREVGKIIGL
EHPLIPVQHQYVVTSTIPEVKALKRELPVLRDLEGSYYLRQERDGLLFGPYESQEKMKVQ
DSWVTNGVPPGFGKELFESDLDRIMEYIEIAMEMVPVLKNADIINVVNGPITYSPDILPM
VGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSDWILHGEPPFDLIELDPNRYGKWTTTQYT
EAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYRSLESKCSMGFHAGWEQPHWFYKPGQ
DTQYRPSFRRTNWFEPVGSEYKQVMQRVGVIDLTPFGKFNIKGRDSIRLLDRLFANIIPK
VGFTNISHMLTPKGRVYAELTVSHQCPGEFLLITGSGSELHDLRWIEEEAVKGGYDVEIK
NITDEFGVLGVAGPRARKILQKLTSEDLSEDVFKFLQTKSLKISNIPVTAIRISYTGELG
WELYHRREDSVALYDMIMNAGQEEGIDNFGTYAMNALRLEKAFRAWGSEMNCDTNPLEAG
LEYFVKLNKCQNSCFAHFKEENGWVSRWAIRPY
Download sequence
Identical sequences F6QKD4
ENSCJAP00000036765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]